PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00010.492
Common NameAMTR_s00010p00263730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 401aa    MW: 44511.3 Da    PI: 9.0895
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00010.492genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like65.69e-212073154
                                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                                              kp l+WtpeLH+ F++ v++LGG ++  Pk ++++m+++gLt+ h+kSHLQ+ R
  evm_27.model.AmTr_v1.0_scaffold00010.492 20 KPMLKWTPELHQLFLDTVARLGGLDEVSPKVMVRAMGIPGLTVFHLKSHLQRER 73
                                              6889***********************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.32E-101876IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-191876IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-142075IPR006447Myb domain, plants
PfamPF143797.1E-9127168IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MERSANEGVI VPLPLTHATK PMLKWTPELH QLFLDTVARL GGLDEVSPKV MVRAMGIPGL  60
TVFHLKSHLQ RERYKRAKAQ GLVHSRSLRN AMSNGDPWIQ SMDAMGGIRR MRGAIFPPDE  120
NIRMEEEAIQ KPISMKREML QRIEVQKHLK LRMEAQTRYL QTVLERAKTA LSSYNLDSSG  180
VEAFRAELSE LALSVVIHDY MDTAISKNKA SEFASPQMEN QRMTGMGASG YHAPKPQVNY  240
GSGNSTLSSP KSPLTSLTMD VSMQGHNYEL RFNKSCVELI PVMRGGPMVA TNRASRSING  300
NNAVSLILQM GADRKEEGQE PPLGRKSVRM EECKRVKETD IGIRETDMEP PHVDQVSSVS  360
FMKSVEPSDK LGNHENGGLK LVMGFDLNAC CDPLIIAIDK *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW1NG980.0W1NG98_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.41e-37myb-related protein 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]